Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Narrow-clawed crayfish Protein: Pon l 4 | Sarcoplasmic Calcium-Binding Protein
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 192 amino acids
AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNLWNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESANAVYLFGPLKEVQ
UniProt: P05946 IUIS: Pon l 4Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | AYSWDNR | V | 0 | 0.29 | 0.09218 |
| R | YMYDIDNNGFLDK | N | 0 | 0.544 | 0.2747 |
| K | NDFECLALR | N | 0 | 0.496 | 0.45352 |
| R | NTLIEGR | G | 0 | 0.268 | 0.22318 |
| R | GEFNEAAYANNQK | I | 0 | 0.486 | 0.44604 |
| K | IMSNLWNEIAELADFNK | D | 0 | 0.521 | 0.09748 |
| K | DGEVTIDEFK | K | 0 | 0.358 | 0.60702 |
| K | AVQNVCVGK | A | 0 | 0.369 | 0.53458 |
| K | AFATFPAAFK | V | 0 | 0.49 | 0.5367 |
| K | VFIANQFK | T | 0 | 0.363 | 0.27084 |
| K | TVDVNGDGLVGVDEYR | L | 0 | 0.635 | 0.55202 |
| R | SAFANIK | E | 0 | 0.236 | 0.24678 |
| K | EIDDAYNK | L | 0 | 0.257 | 0.23824 |
| K | LATDADK | K | 0 | 0.212 | 0.09192 |
| K | AGGISLAR | Y | 0 | 0.26 | 0.4652 |
| R | YQELYAQFISNPDESANAVYLFGPLK | E | 0 | 0.545 | 0.03516 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.